Lineage for d3lx1a1 (3lx1 A:2-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977526Species Thermococcus kodakarensis [TaxId:311400] [226061] (2 PDB entries)
  8. 2977527Domain d3lx1a1: 3lx1 A:2-122 [265042]
    automated match to d1iz5a1
    complexed with so4

Details for d3lx1a1

PDB Entry: 3lx1 (more details), 2 Å

PDB Description: Crystal Structure analysis of PCNA1 from Thermococcus kodakaraensis tk0535
PDB Compounds: (A:) DNA polymerase sliding clamp 1

SCOPe Domain Sequences for d3lx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lx1a1 d.131.1.0 (A:2-122) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
pfevvfdgakefadliatasnlideaafkfteegismramdpsrvvlidlnlpesifsky
eveepetiginmdqfkkilkrgkakdtlilrkgdenfleitfegtakrtfrlplidveel
e

SCOPe Domain Coordinates for d3lx1a1:

Click to download the PDB-style file with coordinates for d3lx1a1.
(The format of our PDB-style files is described here.)

Timeline for d3lx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lx1a2