![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:311400] [226061] (2 PDB entries) |
![]() | Domain d3lx1a1: 3lx1 A:2-122 [265042] automated match to d1iz5a1 complexed with so4 |
PDB Entry: 3lx1 (more details), 2 Å
SCOPe Domain Sequences for d3lx1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lx1a1 d.131.1.0 (A:2-122) automated matches {Thermococcus kodakarensis [TaxId: 311400]} pfevvfdgakefadliatasnlideaafkfteegismramdpsrvvlidlnlpesifsky eveepetiginmdqfkkilkrgkakdtlilrkgdenfleitfegtakrtfrlplidveel e
Timeline for d3lx1a1: