Lineage for d1dazd_ (1daz D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15715Domain d1dazd_: 1daz D: [26502]

Details for d1dazd_

PDB Entry: 1daz (more details), 1.55 Å

PDB Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease

SCOP Domain Sequences for d1dazd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dazd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOP Domain Coordinates for d1dazd_:

Click to download the PDB-style file with coordinates for d1dazd_.
(The format of our PDB-style files is described here.)

Timeline for d1dazd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dazc_