SCOPe 2.08: Domain d3l0rb1: 3l0r B:3-109

Lineage for d3l0rb1 (3l0r B:3-109)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Soft tick (Ornithodoros moubata) [TaxId:6938] [267850] (1 PDB entry)

8. Domain d3l0rb1: 3l0r B:3-109 [265011]
   Other proteins in same PDB: d3l0ra2, d3l0rb2
   automated match to d3lh4a_
   complexed with cl, gol

Details for d3l0rb1

PDB Entry: 3l0r, 2.45 Å

PDB Description: Crystal Structure of Salivary Cystatin from the Soft Tick Ornithodoros moubata

PDB Compounds: (B:) Cystatin-2

SCOPe Domain Sequences for d3l0rb1:

Sequence; same for both SEQRES and ATOM records:

>d3l0rb1 d.17.1.0 (B:3-109) automated matches {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltieisp
svckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrce

Timeline for d3l0rb1:

• d3l0rb1 first appeared in SCOPe 2.05, called d3l0rb_
  
• d3l0rb1 appears in SCOPe 2.07