Lineage for d3l0ra_ (3l0r A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895675Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1895823Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 1895824Protein automated matches [190558] (10 species)
    not a true protein
  7. 1895882Species Soft tick (Ornithodoros moubata) [TaxId:6938] [267850] (1 PDB entry)
  8. 1895883Domain d3l0ra_: 3l0r A: [265010]
    automated match to d3lh4a_
    complexed with cl, gol

Details for d3l0ra_

PDB Entry: 3l0r (more details), 2.45 Å

PDB Description: Crystal Structure of Salivary Cystatin from the Soft Tick Ornithodoros moubata
PDB Compounds: (A:) Cystatin-2

SCOPe Domain Sequences for d3l0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0ra_ d.17.1.0 (A:) automated matches {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltieisp
svckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrceh

SCOPe Domain Coordinates for d3l0ra_:

Click to download the PDB-style file with coordinates for d3l0ra_.
(The format of our PDB-style files is described here.)

Timeline for d3l0ra_: