Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (10 species) not a true protein |
Species Soft tick (Ornithodoros moubata) [TaxId:6938] [267850] (1 PDB entry) |
Domain d3l0ra_: 3l0r A: [265010] automated match to d3lh4a_ complexed with cl, gol |
PDB Entry: 3l0r (more details), 2.45 Å
SCOPe Domain Sequences for d3l0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l0ra_ d.17.1.0 (A:) automated matches {Soft tick (Ornithodoros moubata) [TaxId: 6938]} ipggwtrqdptearflelahfatssqtegrefydtvvtvkevetqvvagmnykltieisp svckigevqysaeqcvpkdaqqkstcvaviyhvpwqnqksvtsyrceh
Timeline for d3l0ra_: