Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Mesorhizobium loti [TaxId:381] [267849] (1 PDB entry) |
Domain d3kxph_: 3kxp H: [265003] automated match to d3qyjb_ complexed with cl |
PDB Entry: 3kxp (more details), 2.26 Å
SCOPe Domain Sequences for d3kxph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kxph_ c.69.1.0 (H:) automated matches {Mesorhizobium loti [TaxId: 381]} hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv vvvpgadhyvnevspeitlkaitnfida
Timeline for d3kxph_: