Lineage for d3kxpa_ (3kxp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153116Species Mesorhizobium loti [TaxId:381] [267849] (1 PDB entry)
  8. 2153117Domain d3kxpa_: 3kxp A: [264996]
    automated match to d3qyjb_
    complexed with cl

Details for d3kxpa_

PDB Entry: 3kxp (more details), 2.26 Å

PDB Description: crystal structure of e-2-(acetamidomethylene)succinate hydrolase
PDB Compounds: (A:) Alpha-(N-acetylaminomethylene)succinic acid hydrolase

SCOPe Domain Sequences for d3kxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kxpa_ c.69.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}
hfisrrvdigritlnvrekgsgplmlffhgitsnsavfeplmirlsdrfttiavdqrghg
lsdkpetgyeandyaddiaglirtlarghailvghslgarnsvtaaakypdlvrsvvaid
ftpyietealdalearvnagsqlfedikaveaylagrypnipadairiraesgyqpvdgg
lrplassaamaqtarglrsdlvpayrdvtkpvlivrgessklvsaaalaktsrlrpdlpv
vvvpgadhyvnevspeitlkaitnfida

SCOPe Domain Coordinates for d3kxpa_:

Click to download the PDB-style file with coordinates for d3kxpa_.
(The format of our PDB-style files is described here.)

Timeline for d3kxpa_: