SCOP 1.57: Domain d1qu4c1: 1qu4 C:35-43,C:284-411

Lineage for d1qu4c1 (1qu4 C:35-43,C:284-411)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Eukaryotic ornithine decarboxylase [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)

8. Domain d1qu4c1: 1qu4 C:35-43,C:284-411 [26499]
   Other proteins in same PDB: d1qu4a2, d1qu4b2, d1qu4c2, d1qu4d2

Details for d1qu4c1

PDB Entry: 1qu4, 2.9 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase

SCOP Domain Sequences for d1qu4c1:

Sequence, based on SEQRES records:

>d1qu4c1 b.49.2.1 (C:35-43,C:284-411) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
degdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsg

Sequence, based on observed residues (ATOM records):

>d1qu4c1 b.49.2.1 (C:35-43,C:284-411) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
degdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepip
neklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiy
yvvsg

Timeline for d1qu4c1:

• d1qu4c1 first appeared (with stable ids) in SCOP 1.55
  
• d1qu4c1 appears in SCOP 1.59
  
• d1qu4c1 appears in the current release, SCOPe 2.08