Lineage for d3kmra_ (3kmr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729413Protein Retinoic acid receptor alpha (RAR-alpha) [48513] (1 species)
  7. 2729414Species Human (Homo sapiens) [TaxId:9606] [48514] (2 PDB entries)
  8. 2729415Domain d3kmra_: 3kmr A: [264988]
    protein/DNA complex; complexed with eqn

Details for d3kmra_

PDB Entry: 3kmr (more details), 1.8 Å

PDB Description: Crystal structure of RARalpha ligand binding domain in complex with an agonist ligand (Am580) and a coactivator fragment
PDB Compounds: (A:) retinoic acid receptor alpha

SCOPe Domain Sequences for d3kmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmra_ a.123.1.1 (A:) Retinoic acid receptor alpha (RAR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pevgeliekvrkahqetfpalcqlgkyttnnsseqrvsldidlwdkfselstkciiktve
fakqlpgfttltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
fgpltdlvfafanqllplemddaetgllsaiclicgdrqdleqpdrvdmlqepllealkv
yvrkrrpsrphmfpkmlmkitdlrsisakgaervitlkmeipgsmppliqemle

SCOPe Domain Coordinates for d3kmra_:

Click to download the PDB-style file with coordinates for d3kmra_.
(The format of our PDB-style files is described here.)

Timeline for d3kmra_: