Lineage for d3kh9a1 (3kh9 A:26-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880198Species Pseudomonas aeruginosa [TaxId:287] [267848] (3 PDB entries)
  8. 2880200Domain d3kh9a1: 3kh9 A:26-175 [264987]
    Other proteins in same PDB: d3kh9a2
    automated match to d2b1ka_

Details for d3kh9a1

PDB Entry: 3kh9 (more details), 2.2 Å

PDB Description: Crystal structure of the periplasmic soluble domain of oxidized CcmG from Pseudomonas aeruginosa
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbE

SCOPe Domain Sequences for d3kh9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kh9a1 c.47.1.0 (A:26-175) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ldpselpsaligkpfpafdlpsvqdparrlteadlkgkpalvnvwgtwcpscrvehpelt
rlaeqgvviyginykddnaaaikwlnelhnpyllsisdadgtlgldlgvygapetylidk
qgiirhkivgvvdqkvwreqlaplyqqlld

SCOPe Domain Coordinates for d3kh9a1:

Click to download the PDB-style file with coordinates for d3kh9a1.
(The format of our PDB-style files is described here.)

Timeline for d3kh9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kh9a2