| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [267848] (3 PDB entries) |
| Domain d3kh9a1: 3kh9 A:26-175 [264987] Other proteins in same PDB: d3kh9a2 automated match to d2b1ka_ |
PDB Entry: 3kh9 (more details), 2.2 Å
SCOPe Domain Sequences for d3kh9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kh9a1 c.47.1.0 (A:26-175) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ldpselpsaligkpfpafdlpsvqdparrlteadlkgkpalvnvwgtwcpscrvehpelt
rlaeqgvviyginykddnaaaikwlnelhnpyllsisdadgtlgldlgvygapetylidk
qgiirhkivgvvdqkvwreqlaplyqqlld
Timeline for d3kh9a1: