Lineage for d3kg2d3 (3kg2 D:508-632,D:774-817)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629262Superfamily f.14.2: Ligand-gated ion channels [267604] (1 family) (S)
  5. 2629263Family f.14.2.1: Ionotropic glutamate receptor 2 (GluR2) ligand channel domain [267620] (1 protein)
    Pfam PF00060, PubMed 19946266
  6. 2629264Protein Ionotropic glutamate receptor 2 (GluR2) ligand channel domain [267662] (1 species)
  7. 2629265Species Norway rat (Rattus norvegicus) [TaxId:10116] [267741] (1 PDB entry)
  8. 2629269Domain d3kg2d3: 3kg2 D:508-632,D:774-817 [264985]
    Other proteins in same PDB: d3kg2a1, d3kg2a2, d3kg2b1, d3kg2b2, d3kg2c1, d3kg2c2, d3kg2d1, d3kg2d2
    protein/RNA complex; complexed with zk1

Details for d3kg2d3

PDB Entry: 3kg2 (more details), 3.6 Å

PDB Description: ampa subtype ionotropic glutamate receptor in complex with competitive antagonist zk 200775
PDB Compounds: (D:) Glutamate receptor 2

SCOPe Domain Sequences for d3kg2d3:

Sequence, based on SEQRES records: (download)

>d3kg2d3 f.14.2.1 (D:508-632,D:774-817) Ionotropic glutamate receptor 2 (GluR2) ligand channel domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspyewhteefedgretqsses
tnefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltve
rmvspXgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk

Sequence, based on observed residues (ATOM records): (download)

>d3kg2d3 f.14.2.1 (D:508-632,D:774-817) Ionotropic glutamate receptor 2 (GluR2) ligand channel domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefgifnslwfslgafmqprsl
sgrivggvwwfftliiissytanlaafltvermvspXgakdsgskektsalslsnvagvf
yilvgglglamlvaliefcyk

SCOPe Domain Coordinates for d3kg2d3:

Click to download the PDB-style file with coordinates for d3kg2d3.
(The format of our PDB-style files is described here.)

Timeline for d3kg2d3: