SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3kg2d1 (3kg2 D:10-388)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143811Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2143812Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries)
  8. 2143825Domain d3kg2d1: 3kg2 D:10-388 [264983]
    Other proteins in same PDB: d3kg2a2, d3kg2a3, d3kg2b2, d3kg2b3, d3kg2c2, d3kg2c3, d3kg2d2, d3kg2d3
    protein/RNA complex; complexed with zk1

Details for d3kg2d1

PDB Entry: 3kg2 (more details), 3.6 Å

PDB Description: ampa subtype ionotropic glutamate receptor in complex with competitive antagonist zk 200775
PDB Compounds: (D:) Glutamate receptor 2

SCOPe Domain Sequences for d3kg2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kg2d1 c.93.1.1 (D:10-388) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvlteddts

SCOPe Domain Coordinates for d3kg2d1:

Click to download the PDB-style file with coordinates for d3kg2d1.
(The format of our PDB-style files is described here.)

Timeline for d3kg2d1: