Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (8 PDB entries) |
Domain d3kg2c1: 3kg2 C:10-388 [264980] Other proteins in same PDB: d3kg2a2, d3kg2a3, d3kg2b2, d3kg2b3, d3kg2c2, d3kg2c3, d3kg2d2, d3kg2d3 protein/RNA complex; complexed with zk1 |
PDB Entry: 3kg2 (more details), 3.6 Å
SCOPe Domain Sequences for d3kg2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kg2c1 c.93.1.1 (C:10-388) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]} nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfggaevsgfqivd yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr kigywsevdkmvlteddts
Timeline for d3kg2c1: