SCOPe 2.08: Domain d3kg2b3: 3kg2 B:508-632,B:774-817

Lineage for d3kg2b3 (3kg2 B:508-632,B:774-817)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.2: Ligand-gated ion channels [267604] (1 family)

5. Family f.14.2.1: Ionotropic glutamate receptor 2 (GluR2) ligand channel domain [267620] (1 protein)
   Pfam PF00060, PubMed 19946266

6. Protein Ionotropic glutamate receptor 2 (GluR2) ligand channel domain [267662] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267741] (1 PDB entry)

8. Domain d3kg2b3: 3kg2 B:508-632,B:774-817 [264979]
   Other proteins in same PDB: d3kg2a1, d3kg2a2, d3kg2b1, d3kg2b2, d3kg2c1, d3kg2c2, d3kg2d1, d3kg2d2
   protein/RNA complex; complexed with zk1

Details for d3kg2b3

PDB Entry: 3kg2, 3.6 Å

PDB Description: ampa subtype ionotropic glutamate receptor in complex with competitive antagonist zk 200775

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3kg2b3:

Sequence, based on SEQRES records:

>d3kg2b3 f.14.2.1 (B:508-632,B:774-817) Ionotropic glutamate receptor 2 (GluR2) ligand channel domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkskpgvfsfldplayeiwmcivfayigvsvvlflvsrfspyewhteefedgretqsses
tnefgifnslwfslgafmqqgadisprslsgrivggvwwfftliiissytanlaafltve
rmvspXgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyk

Sequence, based on observed residues (ATOM records):

>d3kg2b3 f.14.2.1 (B:508-632,B:774-817) Ionotropic glutamate receptor 2 (GluR2) ligand channel domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qkskpgvfsfldplayeiwmcivfayigvsvvlflvstnefgifnslwfslgafmqprsl
sgrivggvwwfftliiissytanlaafltvermvspXgakdsgskektsalslsnvagvf
yilvgglglamlvaliefcyk

Timeline for d3kg2b3:

• d3kg2b3 first appeared in SCOPe 2.05
  
• d3kg2b3 appears in SCOPe 2.07