Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries) |
Domain d3kg2b2: 3kg2 B:389-507,B:633-773 [264978] Other proteins in same PDB: d3kg2a1, d3kg2a3, d3kg2b1, d3kg2b3, d3kg2c1, d3kg2c3, d3kg2d1, d3kg2d3 protein/RNA complex; complexed with zk1 |
PDB Entry: 3kg2 (more details), 3.6 Å
SCOPe Domain Sequences for d3kg2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kg2b2 c.94.1.1 (B:389-507,B:633-773) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]} gleqktvvvttilespyvmmkanhaalagneryegycvdlaaeiakhcgfkykltivgdg kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpX iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk lseqglldklknkwwydkgec
Timeline for d3kg2b2: