Lineage for d3kg2a2 (3kg2 A:389-507,A:633-773)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913899Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)
  8. 2914250Domain d3kg2a2: 3kg2 A:389-507,A:633-773 [264975]
    Other proteins in same PDB: d3kg2a1, d3kg2a3, d3kg2b1, d3kg2b3, d3kg2c1, d3kg2c3, d3kg2d1, d3kg2d3
    protein/RNA complex; complexed with zk1

Details for d3kg2a2

PDB Entry: 3kg2 (more details), 3.6 Å

PDB Description: ampa subtype ionotropic glutamate receptor in complex with competitive antagonist zk 200775
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d3kg2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kg2a2 c.94.1.1 (A:389-507,A:633-773) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
gleqktvvvttilespyvmmkanhaalagneryegycvdlaaeiakhcgfkykltivgdg
kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpX
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk
lseqglldklknkwwydkgec

SCOPe Domain Coordinates for d3kg2a2:

Click to download the PDB-style file with coordinates for d3kg2a2.
(The format of our PDB-style files is described here.)

Timeline for d3kg2a2: