SCOPe 2.08: Domain d3kfla2: 3kfl A:575-736

Lineage for d3kfla2 (3kfl A:575-736)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [267847] (2 PDB entries)

8. Domain d3kfla2: 3kfl A:575-736 [264973]
   Other proteins in same PDB: d3kfla1
   automated match to d4eg8b2
   protein/RNA complex; complexed with edo, fmt, me8, mg, pop, zn

Details for d3kfla2

PDB Entry: 3kfl, 2 Å

PDB Description: Leishmania major methionyl-tRNA synthetase in complex with methionyladenylate and pyrophosphate

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3kfla2:

Sequence; same for both SEQRES and ATOM records:

>d3kfla2 a.27.1.0 (A:575-736) automated matches {Leishmania major [TaxId: 5664]}
adtlgnlvsrcvapkinvngmwpepaeysesdktliaslnnlagtvdhyyclpdiqhali
aifdvlrslnayvtenapwklvkmdtarlgtvlyvtmeglrictmflqpvmpqkakeimd
algvpeaarvgmenylfgivkpgtkiaglaegqvvfqkvtlp

Timeline for d3kfla2:

• d3kfla2 first appeared in SCOPe 2.05
  
• d3kfla2 appears in SCOPe 2.07