Lineage for d3kfla2 (3kfl A:575-736)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991912Species Leishmania major [TaxId:5664] [267847] (1 PDB entry)
  8. 1991913Domain d3kfla2: 3kfl A:575-736 [264973]
    Other proteins in same PDB: d3kfla1
    automated match to d4eg8b2
    protein/RNA complex; complexed with edo, fmt, me8, mg, pop, zn

Details for d3kfla2

PDB Entry: 3kfl (more details), 2 Å

PDB Description: Leishmania major methionyl-tRNA synthetase in complex with methionyladenylate and pyrophosphate
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3kfla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfla2 a.27.1.0 (A:575-736) automated matches {Leishmania major [TaxId: 5664]}
adtlgnlvsrcvapkinvngmwpepaeysesdktliaslnnlagtvdhyyclpdiqhali
aifdvlrslnayvtenapwklvkmdtarlgtvlyvtmeglrictmflqpvmpqkakeimd
algvpeaarvgmenylfgivkpgtkiaglaegqvvfqkvtlp

SCOPe Domain Coordinates for d3kfla2:

Click to download the PDB-style file with coordinates for d3kfla2.
(The format of our PDB-style files is described here.)

Timeline for d3kfla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kfla1