Lineage for d3kbra_ (3kbr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146107Species Pseudomonas aeruginosa [TaxId:287] [195692] (3 PDB entries)
  8. 2146108Domain d3kbra_: 3kbr A: [264971]
    automated match to d4i62a_
    complexed with cl, epe, fmt, gol, ni

Details for d3kbra_

PDB Entry: 3kbr (more details), 1.66 Å

PDB Description: The crystal structure of cyclohexadienyl dehydratase precursor from Pseudomonas aeruginosa PA01
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d3kbra_:

Sequence, based on SEQRES records: (download)

>d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwl

Sequence, based on observed residues (ATOM records): (download)

>d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwl

SCOPe Domain Coordinates for d3kbra_:

Click to download the PDB-style file with coordinates for d3kbra_.
(The format of our PDB-style files is described here.)

Timeline for d3kbra_: