Lineage for d3k9yb_ (3k9y B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005767Species Norway rat (Rattus norvegicus) [TaxId:10116] [267845] (2 PDB entries)
  8. 2005771Domain d3k9yb_: 3k9y B: [264970]
    automated match to d3t3qa_
    complexed with cm5, hem

Details for d3k9yb_

PDB Entry: 3k9y (more details), 2.8 Å

PDB Description: Crystal structure of rat mitochondrial P450 24A1 S57D in complex with CYMAL-5
PDB Compounds: (B:) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial

SCOPe Domain Sequences for d3k9yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9yb_ a.104.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rnvtdlpgptnwpllgslleifwkgglkkqhdtlaeyhkkygqifrmklgsfdsvhlgsp
sllealyrtesahpqrleikpwkayrdhrneayglmilegqewqrvrsafqkklmkpvei
mkldkkinevladflermdelcdergripdlyselnkwsfesiclvlyekrfgllqkete
eealtfitaiktmmstfgkmmvtpvelhkrlntkvwqahtlawdtifksvkpcidnrlqr
ysqqpgadflcdiyqqdhlskkelyaavtelqlaavettanslmwilynlsrnpqaqrrl
lqevqsvlpdnqtpraedlrnmpylkaclkesmrltpsvpfttrtldkptvlgeyalpkg
tvltlntqvlgssednfedshkfrperwlqkekkinpfahlpfgigkrmcigrrlaelql
hlalcwiiqkydivatdnepvemlhlgilvpsrelpiafrpr

SCOPe Domain Coordinates for d3k9yb_:

Click to download the PDB-style file with coordinates for d3k9yb_.
(The format of our PDB-style files is described here.)

Timeline for d3k9yb_: