Lineage for d1qu4a1 (1qu4 A:35-43,A:284-411)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408514Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2408550Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2408567Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 2408573Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
    Uniprot P07805
  8. 2408590Domain d1qu4a1: 1qu4 A:35-43,A:284-411 [26497]
    Other proteins in same PDB: d1qu4a2, d1qu4b2, d1qu4c2, d1qu4d2
    complexed with plp

Details for d1qu4a1

PDB Entry: 1qu4 (more details), 2.9 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase
PDB Compounds: (A:) ornithine decarboxylase

SCOPe Domain Sequences for d1qu4a1:

Sequence, based on SEQRES records: (download)

>d1qu4a1 b.49.2.3 (A:35-43,A:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
degdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsg

Sequence, based on observed residues (ATOM records): (download)

>d1qu4a1 b.49.2.3 (A:35-43,A:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
degdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepip
neklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiy
yvvsg

SCOPe Domain Coordinates for d1qu4a1:

Click to download the PDB-style file with coordinates for d1qu4a1.
(The format of our PDB-style files is described here.)

Timeline for d1qu4a1: