SCOP 1.73: Domain d1qu4a1: 1qu4 A:35-43,A:284-411

Lineage for d1qu4a1 (1qu4 A:35-43,A:284-411)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)

8. Domain d1qu4a1: 1qu4 A:35-43,A:284-411 [26497]
   Other proteins in same PDB: d1qu4a2, d1qu4b2, d1qu4c2, d1qu4d2

Details for d1qu4a1

PDB Entry: 1qu4, 2.9 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase

PDB Compounds: (A:) ornithine decarboxylase

SCOP Domain Sequences for d1qu4a1:

Sequence, based on SEQRES records:

>d1qu4a1 b.49.2.3 (A:35-43,A:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
degdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsg

Sequence, based on observed residues (ATOM records):

>d1qu4a1 b.49.2.3 (A:35-43,A:284-411) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
degdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepip
neklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiy
yvvsg

Timeline for d1qu4a1:

• d1qu4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1qu4a1 appears in SCOP 1.71
  
• d1qu4a1 appears in SCOP 1.75
  
• d1qu4a1 appears in the current release, SCOPe 2.08