Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [267845] (2 PDB entries) |
Domain d3k9vb_: 3k9v B: [264968] automated match to d3t3qa_ complexed with cps, hem |
PDB Entry: 3k9v (more details), 2.5 Å
SCOPe Domain Sequences for d3k9vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9vb_ a.104.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} etrnvtdlpgptnwpllgslleifwkgglkkqhdtlaeyhkkygqifrmklgsfdsvhlg spsllealyrtesahpqrleikpwkayrdhrneayglmilegqewqrvrsafqkklmkpv eimkldkkinevladflermdelcdergripdlyselnkwsfesiclvlyekrfgllqke teeealtfitaiktmmstfgkmmvtpvelhkrlntkvwqahtlawdtifksvkpcidnrl qrysqqpgadflcdiyqqdhlskkelyaavtelqlaavettanslmwilynlsrnpqaqr rllqevqsvlpdnqtpraedlrnmpylkaclkesmrltpsvpfttrtldkptvlgeyalp kgtvltlntqvlgssednfedshkfrperwlqkekkinpfahlpfgigkrmcigrrlael qlhlalcwiiqkydivatdnepvemlhlgilvpsrelpiafrpr
Timeline for d3k9vb_: