SCOPe 2.08: Domain d3k9aa1: 3k9a A:15-94

Lineage for d3k9aa1 (3k9a A:15-94)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d3k9aa1: 3k9a A:15-94 [264966]
   Other proteins in same PDB: d3k9aa2
   automated match to d3wfva_

Details for d3k9aa1

PDB Entry: 3k9a, 2.1 Å

PDB Description: Crystal Structure of HIV gp41 with MPER

PDB Compounds: (A:) HIV glycoprotein gp41

SCOPe Domain Sequences for d3k9aa1:

Sequence; same for both SEQRES and ATOM records:

>d3k9aa1 h.3.2.1 (A:15-94) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
givqqqsnllraieaqqhllqltvwgikqggggsewereisnytdiiyrlieesqnqqek
neqellaldkwaslwnwfdi

Timeline for d3k9aa1:

• d3k9aa1 first appeared in SCOPe 2.05, called d3k9aa_
  
• d3k9aa1 appears in SCOPe 2.07