SCOPe 2.06: Domain d3k8na_: 3k8n A:

Lineage for d3k8na_ (3k8n A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267844] (1 PDB entry)

8. Domain d3k8na_: 3k8n A: [264965]
   automated match to d2b1ka_

Details for d3k8na_

PDB Entry: 3k8n, 2.3 Å

PDB Description: crystal structure of e. coli ccmg

PDB Compounds: (A:) Cytochrome c biogenesis protein ccmG

SCOPe Domain Sequences for d3k8na_:

Sequence; same for both SEQRES and ATOM records:

>d3k8na_ c.47.1.10 (A:) automated matches {Escherichia coli [TaxId: 83333]}
ddptnlesaligkpvpkfrlesldnpgqfyqadvltqgkpvllnvwatwcptcraehqyl
nqlsaqgirvvgmnykddrqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflid
gngiiryrhagdlnprvweeeikplwekyskea

Timeline for d3k8na_:

• d3k8na_ first appeared in SCOPe 2.05
  
• d3k8na_ appears in SCOPe 2.07
  
• d3k8na_ appears in the current release, SCOPe 2.08