Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (19 species) not a true protein |
Species Escherichia coli [TaxId:83333] [267844] (1 PDB entry) |
Domain d3k8na_: 3k8n A: [264965] automated match to d2b1ka_ |
PDB Entry: 3k8n (more details), 2.3 Å
SCOPe Domain Sequences for d3k8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k8na_ c.47.1.10 (A:) automated matches {Escherichia coli [TaxId: 83333]} ddptnlesaligkpvpkfrlesldnpgqfyqadvltqgkpvllnvwatwcptcraehqyl nqlsaqgirvvgmnykddrqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflid gngiiryrhagdlnprvweeeikplwekyskea
Timeline for d3k8na_: