Lineage for d3k1za_ (3k1z A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884071Species Human (Homo sapiens) [TaxId:9606] [188990] (12 PDB entries)
  8. 1884072Domain d3k1za_: 3k1z A: [264964]
    automated match to d2om6a_
    complexed with edo, gol

Details for d3k1za_

PDB Entry: 3k1z (more details), 1.55 Å

PDB Description: crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3)
PDB Compounds: (A:) Haloacid dehalogenase-like hydrolase domain-containing protein 3

SCOPe Domain Sequences for d3k1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k1za_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrlltwdvkdtllrlrhplgeayatkarahglevepsaleqgfrqayraqshsfpnygls
hgltsrqwwldvvlqtfhlagvqdaqavapiaeqlykdfshpctwqvldgaedtlrecrt
rglrlavisnfdrrlegilgglglrehfdfvltseaagwpkpdprifqealrlahmepvv
aahvgdnylcdyqgpravgmhsflvvgpqaldpvvrdsvpkehilpslahllpaldcleg
s

SCOPe Domain Coordinates for d3k1za_:

Click to download the PDB-style file with coordinates for d3k1za_.
(The format of our PDB-style files is described here.)

Timeline for d3k1za_: