Lineage for d3jw8b_ (3jw8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871215Species Human (Homo sapiens) [TaxId:9606] [188340] (51 PDB entries)
  8. 1871228Domain d3jw8b_: 3jw8 B: [264961]
    automated match to d3pe6a_
    complexed with mpd, mrd

Details for d3jw8b_

PDB Entry: 3jw8 (more details), 2.1 Å

PDB Description: Crystal structure of human mono-glyceride lipase
PDB Compounds: (B:) MGLL protein

SCOPe Domain Sequences for d3jw8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw8b_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarmlmgldllvfahdh
vghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmggaiailtaaerpg
hfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvlsrnktevdiynsd
plicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskgayllmelaksq
dktlkiyegayhvlhkelpevtnsvfheinmwvsqrta

SCOPe Domain Coordinates for d3jw8b_:

Click to download the PDB-style file with coordinates for d3jw8b_.
(The format of our PDB-style files is described here.)

Timeline for d3jw8b_: