SCOPe 2.08: Domain d3jw8a_: 3jw8 A:

Lineage for d3jw8a_ (3jw8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)

8. Domain d3jw8a_: 3jw8 A: [264960]
   automated match to d3pe6a_
   complexed with mpd, mrd

Details for d3jw8a_

PDB Entry: 3jw8, 2.1 Å

PDB Description: Crystal structure of human mono-glyceride lipase

PDB Compounds: (A:) MGLL protein

SCOPe Domain Sequences for d3jw8a_:

Sequence; same for both SEQRES and ATOM records:

>d3jw8a_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml
mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg
aiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvls
rnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdsk
gayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta

Timeline for d3jw8a_:

• d3jw8a_ first appeared in SCOPe 2.05
  
• d3jw8a_ appears in SCOPe 2.07