SCOPe 2.07: Domain d3jthb_: 3jth B:

Lineage for d3jthb_ (3jth B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [267843] (2 PDB entries)

8. Domain d3jthb_: 3jth B: [264959]
   automated match to d4k2ea_

Details for d3jthb_

PDB Entry: 3jth, 2 Å

PDB Description: Crystal structure of a transcriptional regulator HlyU from Vibrio vulnificus CMCP6

PDB Compounds: (B:) Transcription activator HlyU

SCOPe Domain Sequences for d3jthb_:

Sequence; same for both SEQRES and ATOM records:

>d3jthb_ a.4.5.0 (B:) automated matches {Vibrio vulnificus [TaxId: 216895]}
dmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawlrrdg
lvttrkeaqtvyytlkseevkamikllhslyc

Timeline for d3jthb_:

• d3jthb_ first appeared in SCOPe 2.05
  
• d3jthb_ appears in SCOPe 2.06
  
• d3jthb_ appears in the current release, SCOPe 2.08