![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (57 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:216895] [267843] (1 PDB entry) |
![]() | Domain d3jthb_: 3jth B: [264959] automated match to d4k2ea_ |
PDB Entry: 3jth (more details), 2 Å
SCOPe Domain Sequences for d3jthb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jthb_ a.4.5.0 (B:) automated matches {Vibrio vulnificus [TaxId: 216895]} dmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawlrrdg lvttrkeaqtvyytlkseevkamikllhslyc
Timeline for d3jthb_: