SCOPe 2.08: Domain d3j6vp_: 3j6v P:

Lineage for d3j6vp_ (3j6v P:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (3 proteins)

6. Protein Eukaryotic, mitochondrial (28S subunit) [267638] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [267697] (1 PDB entry)

8. Domain d3j6vp_: 3j6v P: [264953]

Details for d3j6vp_

PDB Entry: 3j6v, 7 Å

PDB Description: cryo-em structure of the small subunit of the mammalian mitochondrial ribosome

PDB Compounds: (P:) 28S ribosomal protein S16, mitochondrial

SCOPe Domain Sequences for d3j6vp_:

Sequence; same for both SEQRES and ATOM records:

>d3j6vp_ i.1.1.3 (P:) Eukaryotic, mitochondrial (28S subunit) {Cow (Bos taurus) [TaxId: 9913]}
hltirlalggctnrpfyrivaahnkcprdgrfveqlgsydpmpnshgeklvalnldrirh
wigcgahlskpvekllglsgffplhpmvitnaerlrrkraqevllaaqktdteatetken

Timeline for d3j6vp_:

• d3j6vp_ first appeared in SCOPe 2.05
  
• d3j6vp_ appears in SCOPe 2.07