Lineage for d3j6vj_ (3j6v J:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044201Protein Eukaryotic, mitochondrial (28S subunit) [267638] (1 species)
  7. 3044202Species Cow (Bos taurus) [TaxId:9913] [267697] (1 PDB entry)
  8. 3044208Domain d3j6vj_: 3j6v J: [264948]

Details for d3j6vj_

PDB Entry: 3j6v (more details), 7 Å

PDB Description: cryo-em structure of the small subunit of the mammalian mitochondrial ribosome
PDB Compounds: (J:) 28S ribosomal protein S10, mitochondrial

SCOPe Domain Sequences for d3j6vj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j6vj_ i.1.1.3 (J:) Eukaryotic, mitochondrial (28S subunit) {Cow (Bos taurus) [TaxId: 9913]}
mavravfgalgrrlwqgsknfsvsssrsniakndgfllstsmkwvqfsnlhvdvpkdltk
ptitisdepdtlykrlsvlvkghdkavldsyeyfavlaakelgisvkvhepprkierftl
lksvhifkkhrvqyemrtlyrclelehltgstadvyleyiqrnlpegvamevtktrleql
pehikkpvwettpeekgdsks

SCOPe Domain Coordinates for d3j6vj_:

Click to download the PDB-style file with coordinates for d3j6vj_.
(The format of our PDB-style files is described here.)

Timeline for d3j6vj_: