| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.3: Small subunit [58132] (3 proteins) |
| Protein Eukaryotic, mitochondrial (28S subunit) [267638] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [267697] (1 PDB entry) |
| Domain d3j6vf_: 3j6v F: [264945] |
PDB Entry: 3j6v (more details), 7 Å
SCOPe Domain Sequences for d3j6vf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j6vf_ i.1.1.3 (F:) Eukaryotic, mitochondrial (28S subunit) {Cow (Bos taurus) [TaxId: 9913]}
mpryelalilkamqrpetaaalkrtlealmdrgavvrslenlgertlpykmsahsqrhtr
ggyflvdfyaptttvasimehlsrdidvirpnvvkhpltqevkecegivpvpleeklyst
kkrk
Timeline for d3j6vf_: