SCOP 1.75: Domain d1f3tb1: 1f3t B:14-43,B:284-422

Lineage for d1f3tb1 (1f3t B:14-43,B:284-422)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)
   Uniprot P07805

8. Domain d1f3tb1: 1f3t B:14-43,B:284-422 [26494]
   Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2

Details for d1f3tb1

PDB Entry: 1f3t, 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.

PDB Compounds: (B:) ornithine decarboxylase

SCOP Domain Sequences for d1f3tb1:

Sequence, based on SEQRES records:

>d1f3tb1 b.49.2.3 (B:14-43,B:284-422) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrelks

Sequence, based on observed residues (ATOM records):

>d1f3tb1 b.49.2.3 (B:14-43,B:284-422) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsglpdhvvrelks

Timeline for d1f3tb1:

• d1f3tb1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3tb1 appears in SCOP 1.73
  
• d1f3tb1 appears in SCOPe 2.01
  
• d1f3tb1 appears in the current release, SCOPe 2.08