Lineage for d1f3tb1 (1f3t B:14-43,B:284-422)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15665Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 15666Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 15675Protein Eukaryotic ornithine decarboxylase [50625] (3 species)
  7. 15681Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)
  8. 15687Domain d1f3tb1: 1f3t B:14-43,B:284-422 [26494]
    Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2

Details for d1f3tb1

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.

SCOP Domain Sequences for d1f3tb1:

Sequence, based on SEQRES records: (download)

>d1f3tb1 b.49.2.1 (B:14-43,B:284-422) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrelks

Sequence, based on observed residues (ATOM records): (download)

>d1f3tb1 b.49.2.1 (B:14-43,B:284-422) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsglpdhvvrelks

SCOP Domain Coordinates for d1f3tb1:

Click to download the PDB-style file with coordinates for d1f3tb1.
(The format of our PDB-style files is described here.)

Timeline for d1f3tb1: