Lineage for d1f3ta1 (1f3t A:14-43,A:284-422)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671687Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 671787Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 671815Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 671832Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 671838Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)
  8. 671847Domain d1f3ta1: 1f3t A:14-43,A:284-422 [26493]
    Other proteins in same PDB: d1f3ta2, d1f3tb2, d1f3tc2, d1f3td2

Details for d1f3ta1

PDB Entry: 1f3t (more details), 2 Å

PDB Description: crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product.
PDB Compounds: (A:) ornithine decarboxylase

SCOP Domain Sequences for d1f3ta1:

Sequence, based on SEQRES records: (download)

>d1f3ta1 b.49.2.3 (A:14-43,A:284-422) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkismntcdegdpffvaXftlavnviakkvtpgvqtdvgahaesnaq
sfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgldqiveryyl
pemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrelks

Sequence, based on observed residues (ATOM records): (download)

>d1f3ta1 b.49.2.3 (A:14-43,A:284-422) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
rflegfntrdalckkisgdpffvaXftlavnviakkvtqsfmyyvndgvygsfncilydh
avvrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvg
tssfngfqsptiyyvvsglpdhvvrelks

SCOP Domain Coordinates for d1f3ta1:

Click to download the PDB-style file with coordinates for d1f3ta1.
(The format of our PDB-style files is described here.)

Timeline for d1f3ta1: