Lineage for d2todd1 (2tod D:37-43,D:284-410)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) 
Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins) Protein Eukaryotic ornithine decarboxylase [50625] (3 species) 
Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries) 
Domain d2todd1: 2tod D:37-43,D:284-410 [26492]
Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2
Details for d2todd1
PDB Entry: 2tod (more details), 2 Å
PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine
SCOP Domain Sequences for d2todd1:
Sequence, based on SEQRES records: (download)
>d2todd1 b.49.2.1 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs
Sequence, based on observed residues (ATOM records): (download)
>d2todd1 b.49.2.1 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs
SCOP Domain Coordinates for d2todd1:
Click to download the PDB-style file with coordinates for d2todd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2todd1:
View in 3D
