Lineage for d3j3az3 (3j3a z:498-576)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953505Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species)
  7. 2953532Species Human (Homo sapiens) [TaxId:9606] [419529] (1 PDB entry)
  8. 2953533Domain d3j3az3: 3j3a z:498-576 [264917]
    Other proteins in same PDB: d3j3aa_, d3j3ab_, d3j3ac_, d3j3ad_, d3j3ae_, d3j3af_, d3j3ag_, d3j3az1, d3j3az2, d3j3az4, d3j3az5

Details for d3j3az3

PDB Entry: 3j3a (more details), 5 Å

PDB Description: Structure of the human 40S ribosomal proteins
PDB Compounds: (z:) Elongation factor 2

SCOPe Domain Sequences for d3j3az3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j3az3 d.58.11.1 (z:498-576) Elongation factor 2 (eEF-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kfsvspvvrvaveaknpadlpklveglkrlaksdpmvqciieesgehiiagagelhleic
lkdleedhacipikksdpv

SCOPe Domain Coordinates for d3j3az3:

Click to download the PDB-style file with coordinates for d3j3az3.
(The format of our PDB-style files is described here.)

Timeline for d3j3az3: