Lineage for d3j3az1 (3j3a z:3-359)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846217Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. 1846244Species Homo sapiens [TaxId:9606] [268001] (1 PDB entry)
  8. 1846245Domain d3j3az1: 3j3a z:3-359 [264915]
    Other proteins in same PDB: d3j3aa_, d3j3ab_, d3j3ac_, d3j3ad_, d3j3ae_, d3j3af_, d3j3ag_, d3j3az2, d3j3az3, d3j3az4, d3j3az5

Details for d3j3az1

PDB Entry: 3j3a (more details), 5 Å

PDB Description: Structure of the human 40S ribosomal proteins
PDB Compounds: (z:) Elongation factor 2

SCOPe Domain Sequences for d3j3az1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j3az1 c.37.1.8 (z:3-359) Elongation factor 2 (eEF-2), N-terminal (G) domain {Homo sapiens [TaxId: 9606]}
nftvdqiraimdkkanirnmsviahvdhgkstltdslvckagiiasaragetrftdtrkd
eqercitikstaislfyelsendlnfikqskdgagflinlidspghvdfssevtaalrvt
dgalvvvdcvsgvcvqtetvlrqaiaerikpvlmmnkmdrallelqlepeelyqtfqriv
envnviistygegesgpmgnimidpvlgtvgfgsglhgwaftlkqfaemyvakfaakgeg
qlgpaerakkvedmmkklwgdryfdpangkfsksatspegkklprtfcqlildpifkvfd
aimnfkkeetakliekldikldsedkdkegkpllkavmrrwlpagdallqmitihlp

SCOPe Domain Coordinates for d3j3az1:

Click to download the PDB-style file with coordinates for d3j3az1.
(The format of our PDB-style files is described here.)

Timeline for d3j3az1: