SCOP 1.55: Domain d2todc1: 2tod C:37-43,C:284-410

Lineage for d2todc1 (2tod C:37-43,C:284-410)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family)

5. Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)

6. Protein Eukaryotic ornithine decarboxylase [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (3 PDB entries)

8. Domain d2todc1: 2tod C:37-43,C:284-410 [26491]
   Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todc1

PDB Entry: 2tod, 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todc1:

Sequence, based on SEQRES records:

>d2todc1 b.49.2.1 (C:37-43,C:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records):

>d2todc1 b.49.2.1 (C:37-43,C:284-410) Eukaryotic ornithine decarboxylase {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs

Timeline for d2todc1:

• d2todc1 appears in SCOP 1.57
  
• d2todc1 appears in the current release, SCOPe 2.08