Lineage for d3j39y_ (3j39 Y:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1971481Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 1971555Species Drosophila melanogaster [TaxId:7227] [267999] (2 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b
  8. 1971580Domain d3j39y_: 3j39 Y: [264906]

Details for d3j39y_

PDB Entry: 3j39 (more details), 6 Å

PDB Description: Structure of the D. melanogaster 60S ribosomal proteins
PDB Compounds: (Y:) 60S Ribosomal protein L26

SCOPe Domain Sequences for d3j39y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j39y_ i.1.1.1 (Y:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Drosophila melanogaster [TaxId: 7227]}
kqnpfvsssrrknrkrhfqapshirrrlmsaplskelrqkynvrsmpirrddevqvirgh
fkgnqvgkvvqayrkkfvvyvekiqrenangtnvyvgihpskvlivklkldkdrkailer
rgkgrlaalgk

SCOPe Domain Coordinates for d3j39y_:

Click to download the PDB-style file with coordinates for d3j39y_.
(The format of our PDB-style files is described here.)

Timeline for d3j39y_: