SCOP 1.73: Domain d2todb1: 2tod B:37-43,B:284-410

Lineage for d2todb1 (2tod B:37-43,B:284-410)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Trypanosoma brucei [TaxId:5691] [50628] (5 PDB entries)

8. Domain d2todb1: 2tod B:37-43,B:284-410 [26490]
   Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todb1

PDB Entry: 2tod, 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

PDB Compounds: (B:) protein (ornithine decarboxylase)

SCOP Domain Sequences for d2todb1:

Sequence, based on SEQRES records:

>d2todb1 b.49.2.3 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records):

>d2todb1 b.49.2.3 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei [TaxId: 5691]}
gdpffvaXftlavnviakkvtaqsfmyyvndgvygsfncilydhavvrplpqrepipnek
lypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvv
s

Timeline for d2todb1:

• d2todb1 first appeared (with stable ids) in SCOP 1.55
  
• d2todb1 appears in SCOP 1.71
  
• d2todb1 appears in SCOP 1.75
  
• d2todb1 appears in the current release, SCOPe 2.08