Lineage for d2todb1 (2tod B:37-43,B:284-410)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466323Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 466416Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 466444Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 466461Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 466467Species Trypanosoma brucei [TaxId:5691] [50628] (4 PDB entries)
  8. 466469Domain d2todb1: 2tod B:37-43,B:284-410 [26490]
    Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todb1

PDB Entry: 2tod (more details), 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todb1:

Sequence, based on SEQRES records: (download)

>d2todb1 b.49.2.3 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records): (download)

>d2todb1 b.49.2.3 (B:37-43,B:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakkvtaqsfmyyvndgvygsfncilydhavvrplpqrepipnek
lypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvv
s

SCOP Domain Coordinates for d2todb1:

Click to download the PDB-style file with coordinates for d2todb1.
(The format of our PDB-style files is described here.)

Timeline for d2todb1: