| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [267999] (2 PDB entries) Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b |
| Domain d3j38z_: 3j38 Z: [264881] |
PDB Entry: 3j38 (more details), 6 Å
SCOPe Domain Sequences for d3j38z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j38z_ i.1.1.1 (Z:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rdklnnqvlfdkatyeklykevpayklitpsvvserlkirgslakralielrekglikqv
vqhhsqviytratk
Timeline for d3j38z_: