Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50626] (1 PDB entry) |
Domain d1d7kb1: 1d7k B:7-43,B:284-421 [26487] Other proteins in same PDB: d1d7ka2, d1d7kb2 |
PDB Entry: 1d7k (more details), 2.1 Å
SCOPe Domain Sequences for d1d7kb1:
Sequence, based on SEQRES records: (download)
>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens) [TaxId: 9606]} eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqtgsdd edesseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldr ivercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq
>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens) [TaxId: 9606]} eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqsseqt fmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlp emhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq
Timeline for d1d7kb1: