Lineage for d1d7kb1 (1d7k B:7-43,B:284-421)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408514Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2408550Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 2408567Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 2408568Species Human (Homo sapiens) [TaxId:9606] [50626] (1 PDB entry)
  8. 2408570Domain d1d7kb1: 1d7k B:7-43,B:284-421 [26487]
    Other proteins in same PDB: d1d7ka2, d1d7kb2

Details for d1d7kb1

PDB Entry: 1d7k (more details), 2.1 Å

PDB Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution
PDB Compounds: (B:) human ornithine decarboxylase

SCOPe Domain Sequences for d1d7kb1:

Sequence, based on SEQRES records: (download)

>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens) [TaxId: 9606]}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqtgsdd
edesseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldr
ivercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

Sequence, based on observed residues (ATOM records): (download)

>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens) [TaxId: 9606]}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqsseqt
fmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlp
emhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

SCOPe Domain Coordinates for d1d7kb1:

Click to download the PDB-style file with coordinates for d1d7kb1.
(The format of our PDB-style files is described here.)

Timeline for d1d7kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d7kb2