SCOP 1.67: Domain d1d7kb1: 1d7k B:7-43,B:284-421

Lineage for d1d7kb1 (1d7k B:7-43,B:284-421)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50626] (1 PDB entry)

8. Domain d1d7kb1: 1d7k B:7-43,B:284-421 [26487]
   Other proteins in same PDB: d1d7ka2, d1d7kb2

Details for d1d7kb1

PDB Entry: 1d7k, 2.1 Å

PDB Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution

SCOP Domain Sequences for d1d7kb1:

Sequence, based on SEQRES records:

>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens)}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqtgsdd
edesseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldr
ivercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

Sequence, based on observed residues (ATOM records):

>d1d7kb1 b.49.2.3 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase (ODC) {Human (Homo sapiens)}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqsseqt
fmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlp
emhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

Timeline for d1d7kb1:

• d1d7kb1 first appeared (with stable ids) in SCOP 1.55
  
• d1d7kb1 appears in SCOP 1.65
  
• d1d7kb1 appears in SCOP 1.69
  
• d1d7kb1 appears in the current release, SCOPe 2.08