Lineage for d1d7kb1 (1d7k B:7-43,B:284-421)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61223Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) (S)
  5. 61224Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins)
  6. 61233Protein Eukaryotic ornithine decarboxylase [50625] (3 species)
  7. 61234Species Human (Homo sapiens) [TaxId:9606] [50626] (1 PDB entry)
  8. 61236Domain d1d7kb1: 1d7k B:7-43,B:284-421 [26487]
    Other proteins in same PDB: d1d7ka2, d1d7kb2

Details for d1d7kb1

PDB Entry: 1d7k (more details), 2.1 Å

PDB Description: crystal structure of human ornithine decarboxylase at 2.1 angstroms resolution

SCOP Domain Sequences for d1d7kb1:

Sequence, based on SEQRES records: (download)

>d1d7kb1 b.49.2.1 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase {Human (Homo sapiens)}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqtgsdd
edesseqtfmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldr
ivercdlpemhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

Sequence, based on observed residues (ATOM records): (download)

>d1d7kb1 b.49.2.1 (B:7-43,B:284-421) Eukaryotic ornithine decarboxylase {Human (Homo sapiens)}
eefdchfldegftakdildqkinevsssddkdafyvaXftlavniiakkivlkeqsseqt
fmyyvndgvygsfncilydhahvkpllqkrpkpderyysssiwgptcdgldrivercdlp
emhvgdwmlfenmgaytvaaastfngfqrptiyyvmsgpawqlmqqfq

SCOP Domain Coordinates for d1d7kb1:

Click to download the PDB-style file with coordinates for d1d7kb1.
(The format of our PDB-style files is described here.)

Timeline for d1d7kb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d7kb2