Lineage for d3j38e_ (3j38 E:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043338Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 3043490Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [267999] (2 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b
  8. 3043521Domain d3j38e_: 3j38 E: [264860]

Details for d3j38e_

PDB Entry: 3j38 (more details), 6 Å

PDB Description: Structure of the D. melanogaster 40S ribosomal proteins
PDB Compounds: (E:) 40s ribosomal protein s4

SCOPe Domain Sequences for d3j38e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j38e_ i.1.1.1 (E:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
margpkkhlkrlaapkawmldklggvfaprpstgphklreslplliflrnrlkyalngae
vtkivmqrlvkvdgkvrtdptypagymdvitlektgeffrlvydvkgrfvihrisaeeak
yklckvkktqlgakgvpflvthdgrtirypdplihandsvqvdiasgkitdyikfdsgnl
cmitggrnlgrvgtvvnrerhpgsfdivhikdsqghvfatrltnvfiigkgnkpyislpk
gkgvklsiaeerdkrlaakth

SCOPe Domain Coordinates for d3j38e_:

Click to download the PDB-style file with coordinates for d3j38e_.
(The format of our PDB-style files is described here.)

Timeline for d3j38e_: