Lineage for d3icxc_ (3icx C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014351Fold a.183: Nop domain [89123] (1 superfamily)
    multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain
  4. 2014352Superfamily a.183.1: Nop domain [89124] (2 families) (S)
  5. 2014361Family a.183.1.0: automated matches [254308] (1 protein)
    not a true family
  6. 2014362Protein automated matches [254709] (2 species)
    not a true protein
  7. 2014366Species Sulfolobus solfataricus [TaxId:2287] [267842] (1 PDB entry)
  8. 2014369Domain d3icxc_: 3icx C: [264843]
    automated match to d3nvia_
    complexed with so4

Details for d3icxc_

PDB Entry: 3icx (more details), 3.1 Å

PDB Description: crystal structure of sulfolobus solfataricus nop5 (135-380)
PDB Compounds: (C:) Pre mRNA splicing protein

SCOPe Domain Sequences for d3icxc_:

Sequence, based on SEQRES records: (download)

>d3icxc_ a.183.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
krdllaiqavramddidktinlfserlrewysihfpeldkliedheeyativsrfgdrgf
ltidslkelgfneqrinrildaakksigadiseddlsamrmiantildlynirrnlnnyl
egvmkevapnvtalvgpalgarllsiagsldelakmpastiqvlgaekalfralrsggrp
pkhgiifqypaihtsprwqrgkiaralaaklaiaarvdafsgrfigdqlneqlkkridei
kekf

Sequence, based on observed residues (ATOM records): (download)

>d3icxc_ a.183.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
krdllaiqavramddidktinlfserlrewysihfpeldkliedheeyativsrfgdrgf
ltidslkelgfneqrinrildaakksigadiseddlsamrmiantildlynirrnlnnyl
egvmkevapnvtalvgpalgarllsiagsldelakmpastiqvlgiifqypaihtsprwq
rgkiaralaaklaiaarvdafsgrfigdqlneqlkkrideikekf

SCOPe Domain Coordinates for d3icxc_:

Click to download the PDB-style file with coordinates for d3icxc_.
(The format of our PDB-style files is described here.)

Timeline for d3icxc_: