![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.183: Nop domain [89123] (1 superfamily) multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain |
![]() | Superfamily a.183.1: Nop domain [89124] (2 families) ![]() |
![]() | Family a.183.1.0: automated matches [254308] (1 protein) not a true family |
![]() | Protein automated matches [254709] (2 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [267842] (1 PDB entry) |
![]() | Domain d3icxb_: 3icx B: [264842] automated match to d3nvia_ complexed with so4 |
PDB Entry: 3icx (more details), 3.1 Å
SCOPe Domain Sequences for d3icxb_:
Sequence, based on SEQRES records: (download)
>d3icxb_ a.183.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} krdllaiqavramddidktinlfserlrewysihfpeldkliedheeyativsrfgdrgf ltidslkelgfneqrinrildaakksigadiseddlsamrmiantildlynirrnlnnyl egvmkevapnvtalvgpalgarllsiagsldelakmpastiqvlgaekalfralrsggrp pkhgiifqypaihtsprwqrgkiaralaaklaiaarvdafsgrfigdqlneqlkkridei kekf
>d3icxb_ a.183.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} krdllaiqavramddidktinlfserlrewysihfpeldkliedheeyativsrfgdrgf ltidslkelgfneqrinrildaakksigadiseddlsamrmiantildlynirrnlnnyl egvmkevapnvtalvgpalgarllsiagsldelakmpastiqvlgiifqypaihtsprwq rgkiaralaaklaiaarvdafsgrfigdqlneqlkkrideikekf
Timeline for d3icxb_: