Lineage for d3i65a_ (3i65 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080463Species Plasmodium falciparum [TaxId:36329] [189697] (5 PDB entries)
  8. 2080464Domain d3i65a_: 3i65 A: [264838]
    automated match to d4cq8a_
    complexed with fmn, jz8, lda, oro

Details for d3i65a_

PDB Entry: 3i65 (more details), 2 Å

PDB Description: Plasmodium falciparum dihydroorotate dehydrogenase bound with triazolopyrimidine-based inhibitor DSM1
PDB Compounds: (A:) Dihydroorotate dehydrogenase homolog, mitochondrial

SCOPe Domain Sequences for d3i65a_:

Sequence, based on SEQRES records: (download)

>d3i65a_ c.1.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
synpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfin
pfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfn
nmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyi
ainvsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvk
lapdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkfi
cemynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhl
lyqrgyynlkeaigrkhs

Sequence, based on observed residues (ATOM records): (download)

>d3i65a_ c.1.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
synpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfin
pfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfn
nmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyi
ainvsspneagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvklapdlnqe
qkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemynytn
kqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgyyn
lkeaigrkhs

SCOPe Domain Coordinates for d3i65a_:

Click to download the PDB-style file with coordinates for d3i65a_.
(The format of our PDB-style files is described here.)

Timeline for d3i65a_: