Lineage for d3hsyb_ (3hsy B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161548Protein Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) [267661] (1 species)
  7. 2161549Species Norway rat (Rattus norvegicus) [TaxId:10116] [267740] (5 PDB entries)
  8. 2161551Domain d3hsyb_: 3hsy B: [264837]
    automated match to d3h5va_
    complexed with nag, so4

Details for d3hsyb_

PDB Entry: 3hsy (more details), 1.75 Å

PDB Description: high resolution structure of a dimeric glur2 n-terminal domain (ntd)
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3hsyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hsyb_ c.93.1.1 (B:) Ionotropic glutamate receptor 2 (GluR2) amino-terminal domain (ATD) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvtlt

SCOPe Domain Coordinates for d3hsyb_:

Click to download the PDB-style file with coordinates for d3hsyb_.
(The format of our PDB-style files is described here.)

Timeline for d3hsyb_: